Fbxo34 Rabbit Polyclonal Antibody

• Catalog Number: orb583432
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Fbxo34
• Target: Fbxo34
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Rat
• Predicted Reactivity: Bovine, Canine, Guinea pig, Human, Mouse, Rabbit
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
• Protein Sequence: Synthetic peptide located within the following region: RDTLRTPMSHGKANGDVKARASYMKPTVLPSASLVKASSRKPFGILSPNV
• UniProt ID: Q80XI1
• MW: 82kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: 2900057B08Rik, 5830426G16Rik
• Note: For research use only
• NCBI: NP_084512

WB Suggested Anti-Fbxo34 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Rat Brain.