Fbxo32 Rabbit Polyclonal Antibody

SKU: orb330701

Description

Rabbit polyclonal antibody to Fbxo32

Research Area

Molecular Biology

Images & Validation

• Tested Applications: WB
• Reactivity: Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide corresponding to a region from the human protein.
• Target: Fbxo32
• Protein Sequence: Synthetic peptide located within the following region: LVRCYPRREQYGVTLQLCKHCHILSWKGTDHPCTANNPESCSVSLSPQDF
• Molecular Weight: 39kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti 4833442G10Rik antibody, anti AI430017 antibody, anti ATROGIN1 antibody, anti MAFbx antibody, anti atrogin-1 antibody, anti Gm20361 antibody

WB Suggested Anti-Fbxo32 Antibody, Titration: 1.0 ug/ml, Positive Control: Mouse Heart.

Quick Database Links

Gene Symbol

Fbxo32

UniProt

Q9CPU7

RefSeq (Protein):NP_080622