FBXO25 Rabbit Polyclonal Antibody

SKU: orb578725

Description

Rabbit polyclonal antibody to FBXO25

Research Area

Protein Biochemistry

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human FBXO25
• Target: FBXO25
• Protein Sequence: Synthetic peptide located within the following region: AKEQYGDTLHFCRHCSILFWKDSGHPCTAADPDSCFTPVSPQHFIDLFKF
• Molecular Weight: 16kDa
• Purification: Protein A purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

FBX25

Human kidney

WB Suggested Anti-FBXO25 Antibody Titration: 1.25 ug/ml, Positive Control: HepG2 cell lysate.

Quick Database Links

Gene Symbol

FBXO25

UniProt

Q8TCJ0

RefSeq:EAW51453