You have no items in your shopping cart.
Cart summary
Item 1 of 1
FASTKD3 Rabbit Polyclonal Antibody
Catalog Number: orb586825
| Catalog Number | orb586825 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to FASTKD3 |
| Target | FASTKD3 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Bovine, Equine |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human FASTKD3 |
| Protein Sequence | Synthetic peptide located within the following region: TMETLPDTMAAGALQRICEVEKKDGDQGLPKEILENSIFQALCFQFEKEP |
| UniProt ID | Q14CZ7 |
| MW | 73kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Note | For research use only |
| NCBI | NP_076996 |
Sample Type: PANC1 Whole cell lysates, Antibody dilution: 1.0 ug/ml.
- Item 1 of 2
Anti-FASTKD3 Antibody [orb515218]
IH, WB
Human, Rat
Rabbit
Polyclonal
Unconjugated
200 μl, 100 μl, 30 μl - Item 1 of 3
FASTKD3 rabbit pAb [orb765207]
ELISA, IHC-P, WB
Human, Mouse, Rat
Polyclonal
Unconjugated
100 μl, 50 μl - Item 1 of 2
- Item 1 of 2
- Item 1 of 1
