FAM40A Rabbit Polyclonal Antibody

• Catalog Number: orb635625
• Category: Antibodies
• Description: Rabbit polyclonal antibody to FAM40A
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human FAM40A
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 92 kDa
• Target: FAM40A
• UniProt ID: Q5VSL9
• Protein Sequence: Synthetic peptide located within the following region: YSYTEGPEFLMNRKCFEEDFRIHVTDKKWTELDTNQHRTHAMRLLDGLEV
• NCBI: NP_149079
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: FAM40A, FAR11A
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Human MCF7 Whole Cell lysates, Antibody Dilution: 3 ug/ml.