Prxl2b Rabbit Polyclonal Antibody

• Catalog Number: orb325804
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Fam213b
• Target: Fam213b
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Human, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Protein Sequence: Synthetic peptide located within the following region: SKQIYKELGFKRYNSLSILPAALGKPVRDVASKAKAVGIQGNLSGDLLQS
• UniProt ID: Q9DB60
• MW: 22kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti Fam213b antibody, anti PM/PGFS antibody, anti
• Research Area: Epigenetics
• Note: For research use only
• NCBI: NP_079858

WB Suggested Anti-2810405K02Rik Antibody, Titration: 1.0 ug/mL, Positive Control: Mouse Thymus.