FAM193A Rabbit Polyclonal Antibody

SKU: orb587414

Description

FAM193A Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of FAM193A. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the C-terminal region of Human FAM193A. This antibody reacts with Human samples and is predicted to react with Canine, Equine, Guinea pig, Mouse, Rat, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Epigenetics

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Canine, Equine, Guinea pig, Mouse, Rat, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human FAM193A
• Target: FAM193A
• Protein Sequence: Synthetic peptide located within the following region: EHQQNSKLVLAESPQPKGKNKKNKKKKGDRVNNSIDGVSLLLPSLGYNGA
• Molecular Weight: 139kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

C4orf8, RES4-22

Quick Database Links

Gene Symbol

FAM193A

UniProt

P78312

RefSeq (Protein):NP_003695