C10orf38 Rabbit Polyclonal Antibody

• Catalog Number: orb325174
• Category: Antibodies
• Description: Rabbit polyclonal antibody to FAM171A1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Guinea pig, Rabbit
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C10orf38
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 98kDa
• Target: FAM171A1
• UniProt ID: Q5VUB5
• Protein Sequence: Synthetic peptide located within the following region: ARKSMEREGYESSGNDDYRGSYNTVLSQPLFEKQDREGPASTGSKLTIQE
• NCBI: NP_001010924
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti FLJ12884 antibody, anti MGC130014 antibody, a
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

WB Suggested Anti-C10orf38 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: 293T cell lysate, FAM171A1 is supported by BioGPS gene expression data to be expressed in HEK293T.