FAM131A Rabbit Polyclonal Antibody

• Catalog Number: orb587401
• Category: Antibodies
• Description: Rabbit polyclonal antibody to FAM131A
• Target: FAM131A
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human FAM131A
• Protein Sequence: Synthetic peptide located within the following region: QDSLYNSPLTESCLSPAEEEPAPCKDCQPLCPPLTGSWERQRQASDLASS
• UniProt ID: G5E9B1
• MW: 39kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: C3orf40, FLAT715, PRO1378
• Note: For research use only
• NCBI: NP_653236

Sample Type: Fetal Lung lysates, Antibody dilution: 1.0 ug/ml.