Faf2 Rabbit Polyclonal Antibody

SKU: orb326419

Description

Rabbit polyclonal antibody to Faf2

Research Area

Cell Biology

Images & Validation

• Tested Applications: WB
• Reactivity: Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Target: Faf2
• Protein Sequence: Synthetic peptide located within the following region: LLQFQDLTGIESMEQCRLALEQHNWNMEAAVQDRLNEQEGVPSVFNPPPA
• Molecular Weight: 52kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti 2210404D11Rik antibody, anti AI462440 antibody, anti Ubxd8 antibody, anti mKIAA0887 antibody

WB Suggested Anti-Faf2 Antibody, Titration: 1.0 ug/mL, Positive Control: Mouse Liver.

Quick Database Links

Gene Symbol

Faf2

UniProt

Q3TDN2

RefSeq (Protein):NP_848484