You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2293115 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody raised against a full-length human FABP5 protein. |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human, Mouse |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Immunogen | FABP5 (NP_001435.1, 1 a.a. ~ 135 a.a) full-length human protein. |
Protein Sequence | MATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVECVMNNVTCTRIYEKVE |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | NP_001435.1 |
FABP5 MaxPab rabbit polyclonal antibody. Western Blot analysis of FABP5 expression in human kidney.
FABP5 MaxPab rabbit polyclonal antibody. Western Blot analysis of FABP5 expression in mouse stomach.
Western Blot analysis of FABP5 expression in transfected 293T cell line by FABP5 MaxPab polyclonal antibody. Lane 1: FABP5 transfected lysate (15.20 KDa). Lane 2: Non-transfected lysate.