F8 Rabbit Polyclonal Antibody

SKU: orb333731

Description

F8 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of F8. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the C terminal region of human F8. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Rabbit, Sheep. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cell Biology

Images & Validation

−

Item 1 of 3

Tested Applications	WB
Reactivity	Human
Predicted Reactivity	Bovine, Canine, Equine, Rabbit, Sheep

Related Conjugates & Formulations

−

Biotin

FITC

HRP

Key Properties

−

Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen is a synthetic peptide directed towards the C terminal region of human F8
Target	F8
Protein Sequence	Synthetic peptide located within the following region: IMVTFRNQASRPYSFYSSLISYEEDQRQGAEPRKNFVKPNETKTYFWKVQ
Molecular Weight	79kDa
Purification	Affinity Purified
Conjugation	Unconjugated

Storage & Handling

−

Storage	Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/Preservatives	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	0.5 mg/ml
Expiration Date	12 months from date of receipt.
Disclaimer	For research use only

Alternative Names

−

Anti-F8 antibody, anti-F8b antibody, anti-F8c antibody, anti-FA8_HUMAN antibody, anti-FactorVIII antibody, anti-FVIII antibody, anti-Factor VIII antibody

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Sample Tissue: Human Ovary Tumor, Antibody dilution: 1 ug/ml.

Sample Type: 721_B Whole Cell, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/ml, Peptide Concentration: 5 ug/ml, Lysate Quantity: 25 ug/lane, Gel Concentration: 0.12%.

WB Suggested Anti-F8 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: 721_B cell lysate.

Quick Database Links

Gene Symbol

UniProt

P00451

RefSeq (Protein):NP_000123

UniProt Details

−

No UniProt data available

NCBI Reference Sequences

−

Associated Accession Numbers

Curated reference sequences for the gene transcript and protein product

Protein	NP_000123

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Western Blot (IB, immunoblot)

View Protocol

Find More Protocols