EZH2 monoclonal antibody (M01), clone 2C3

• Catalog Number: orb2293148
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant EZH2.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 2C3
• Tested applications: ELISA, WB
• Reactivity: Human
• Isotype: IgG2b Kappa
• Immunogen: EZH2 (AAH10858, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MGQTGKKSEKGPVCWRKRVKSEYMRLRQLKRFRRADEVKSMFSSNRQKILERTEILNQEWKQRRIQPVHILTSVSSLRGTRECSVTSDLDFPTQVIPLKTLNAVASVPIM
• NCBI: AAH10858
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

EZH2 monoclonal antibody (M01), clone 2C3 recognizes the appropriate size (95 KDa) full length protein in human prostrate cancer cells (DU145, whole cell extract made in modified RIPA buffer), Primary Ab dilution = 1:1000. Mouse-HRPO dilution = 1:25000.

Western Blot detection against Immunogen (37.84 KDa).