You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2293148 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant EZH2. |
Clonality | Monoclonal |
Species/Host | Mouse |
Isotype | IgG2b Kappa |
Conjugation | Unconjugated |
Reactivity | Human |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Immunogen | EZH2 (AAH10858, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Protein Sequence | MGQTGKKSEKGPVCWRKRVKSEYMRLRQLKRFRRADEVKSMFSSNRQKILERTEILNQEWKQRRIQPVHILTSVSSLRGTRECSVTSDLDFPTQVIPLKTLNAVASVPIM |
Tested applications | ELISA, WB |
Clone Number | 2C3 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | AAH10858 |
EZH2 monoclonal antibody (M01), clone 2C3 recognizes the appropriate size (95 KDa) full length protein in human prostrate cancer cells (DU145, whole cell extract made in modified RIPA buffer), Primary Ab dilution = 1:1000. Mouse-HRPO dilution = 1:25000.
Western Blot detection against Immunogen (37.84 KDa).