EXOC6 Rabbit Polyclonal Antibody

• Catalog Number: orb583522
• Category: Antibodies
• Description: Rabbit polyclonal antibody to EXOC6
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Guinea pig, Rabbit, Rat, Zebrafish
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human EXOC6
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 88kDa
• Target: EXOC6
• UniProt ID: B3KXY5
• Protein Sequence: Synthetic peptide located within the following region: MLEEETDQTYENVLAEIQSFELPVEATLRSVYDDQPNAHKKFMEKLDACI
• NCBI: NP_001013870
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: SEC15, EXOC6A, SEC15L, Sec15p, SEC15L1, SEC15L3
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Type: mouse fibroblast lusate (20 ug), Primary dilution: 1:1000 (2% milk), Secondary dilution: 1:2000 (5% milk).

WB Suggested Anti-EXOC6 Antibody Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate.