You have no items in your shopping cart.
Description
Research Area
Metabolism Research
Images & Validation
−
Key Properties
−| CAS Number | 141758-74-9 |
|---|---|
| MW | 4186.6 Da |
| Purity | > 95% by HPLC |
| Formula | C184H282N50O60S |
| Protein Sequence | H-His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-Asn-His-NH2 |
Storage & Handling
−| Storage | Store desiccated at -20°C in the dark |
|---|---|
| Form/Appearance | Freeze dried solid |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−141758-74-9, Exenatide, Exendin-4GH001, GLP-1, HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2, Heloderma, diabetes mellitus, exenatide, glucagon-like peptide 1, suspectum
Similar Products
−Recombinant Exendin-4 [orb1905926]
> 96 % by SDS-PAGE and HPLC analyses.
Approximately 4.2 kDa, a single non-glycosylated polypeptide chain containing 39 amino acids.
Escherichia coli
100 μg, 500 μgExendin 4 Rabbit Polyclonal Antibody [orb4638]
ELISA, IF, IHC-Fr, IHC-P, WB
Reptile
Rabbit
Polyclonal
Unconjugated
50 μl, 100 μl, 200 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
Exendin-4 (orb1140521)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review









