Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

Exendin-4 (3-39) amide

SKU: orb1140522

Description

Glucagon like peptide 1 (GLP-1) receptor antagonist; Peptides.

Research Area

Metabolism Research

Images & Validation

−

Key Properties

−
CAS Number196109-31-6
MW3992.4 Da
Purity> 95% by HPLC
FormulaC176H272N46O58S
Protein SequenceH-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2

Storage & Handling

−
StorageStore desiccated, frozen and in the dark
Form/AppearanceFreeze dried solid
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

−
196109-31-6, EGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2, Exendin-4 (3-39) amideGH008 ., GLP-1, H-EGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2, antagonist, glucagon-like peptide 1
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.

Protocol Information

Protein Handling and Storage Guide
Protein Handling Guide
View Guide

Available Sizes

Select a size below

1 mg
$ 410.00
DispatchUsually dispatched within 5-10 working days
Bulk Enquiry