FLJ20433 Rabbit Polyclonal Antibody

SKU: orb326267

Description

Rabbit polyclonal antibody to EXD3

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Goat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FLJ20433
• Target: EXD3
• Protein Sequence: Synthetic peptide located within the following region: MGPAGCAFTLLLLLGISVCGQPVYSSRVVGGQDAAAGRWPWQVSLHFDHN
• Molecular Weight: 83kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti FLJ30442 antibody, anti MGC131904 antibody, anti MGC74981 antibody, anti mut-7 antibody, anti FLJ20433 antibody

WB Suggested Anti-FLJ20433 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: Human heart.

Quick Database Links

Gene Symbol

EXD3

UniProt

Q8N9H8

RefSeq (Protein):NP_060290