Erythropoietin Protein, Pig, Recombinant (His)

• Catalog Number: orb1976810
• Category: Proteins
• Description: Hormone involved in the regulation of erythrocyte proliferation and differentiation and the maintenance of a physiological level of circulating erythrocyte mass. Binds to EPOR leading to EPOR dimerization and JAK2 activation thereby activating specific downstream effectors, including STAT1 and STAT3. Erythropoietin Protein, Pig, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 20.6 kDa and the accession number is P49157.
• Tag: N-6xHis
• Purity: 98.00%
• MW: 20.6 kDa (predicted)
• UniProt ID: P49157
• Protein Sequence: APPRLICDSRVLERYILEAKEGENATMGCAESCSFSENITVPDTKVNFYAWKRMEVQQQAMEVWQGLALLSEAILQGQALLANSSQPSEALQLHVDKAVSGLRSLTSLLRALGAQKEAIPLPDASPSSATPLRTFAVDTLCKLFRNYSNFLRGKLTLYTGEACRRRDR
• Expression System: P. pastoris (Yeast)
• Biological Origin: Sus scrofa (Pig)
• Biological Activity: Hormone involved in the regulation of erythrocyte proliferation and differentiation and the maintenance of a physiological level of circulating erythrocyte mass. Binds to EPOR leading to EPOR dimerization and JAK2 activation thereby activating specific downstream effectors, including STAT1 and STAT3. Erythropoietin Protein, Pig, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 20.6 kDa and the accession number is P49157.
• Expression Region: 27-194 aa
• Storage: -20°C
• Note: For research use only
• Application notes: A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
• Expiration Date: 6 months from date of receipt.