You have no items in your shopping cart.
Cart summary
Erythropoietin Protein, Pig, Recombinant (B2M & His)
Catalog Number: orb1976809
| Catalog Number | orb1976809 |
|---|---|
| Category | Proteins |
| Description | Hormone involved in the regulation of erythrocyte proliferation and differentiation and the maintenance of a physiological level of circulating erythrocyte mass. Binds to EPOR leading to EPOR dimerization and JAK2 activation thereby activating specific downstream effectors, including STAT1 and STAT3. Erythropoietin Protein, Pig, Recombinant (B2M & His) is expressed in E. coli expression system with N-6xHis-B2M tag. The predicted molecular weight is 32.6 kDa and the accession number is P49157. |
| Tag | N-6xHis-B2M |
| Purity | 98.00% |
| MW | 32.6 kDa (predicted) |
| UniProt ID | P49157 |
| Protein Sequence | APPRLICDSRVLERYILEAKEGENATMGCAESCSFSENITVPDTKVNFYAWKRMEVQQQAMEVWQGLALLSEAILQGQALLANSSQPSEALQLHVDKAVSGLRSLTSLLRALGAQKEAIPLPDASPSSATPLRTFAVDTLCKLFRNYSNFLRGKLTLYTGEACRRRDR |
| Expression System | E. coli |
| Biological Origin | Sus scrofa (Pig) |
| Biological Activity | Hormone involved in the regulation of erythrocyte proliferation and differentiation and the maintenance of a physiological level of circulating erythrocyte mass. Binds to EPOR leading to EPOR dimerization and JAK2 activation thereby activating specific downstream effectors, including STAT1 and STAT3. Erythropoietin Protein, Pig, Recombinant (B2M & His) is expressed in E. coli expression system with N-6xHis-B2M tag. The predicted molecular weight is 32.6 kDa and the accession number is P49157. |
| Expression Region | 27-194 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Expiration Date | 6 months from date of receipt. |
