You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2293187 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a full-length recombinant ERCC2.This product is belong to Cell Culture Grade Antibody (CX Grade). |
Clonality | Monoclonal |
Species/Host | Mouse |
Isotype | IgG1 Kappa |
Conjugation | Unconjugated |
Reactivity | Human |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Immunogen | ERCC2 (AAH08346, 1 a.a. ~ 405 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Protein Sequence | MRELKRTLDAKGHGVLEMPSGTGKTVSLLALIMAYQRAYPLEVTKLIYCSRTVPEIEKVIEELRKLLNFYEKQEGEKLPFLGLALSSRKNLCIHPEVTPLRFGKDVDGKCHSLTASYVRAQYQHDTSLPHCRFYEEFDAHGREVPLPAGIYNLDDLKALGRRQGWCPYFLARYSILHANVVVYSYHYLLDPKIADLVSKELARKAVVVFDEAHNIDNVCIDSMSVNLTRRTLDRCQGNLETLQKTVLRIKETDEQRLRDEYRRLVEGLREASAARETDAHLANPVLPDEVLQEAVPGSIRTAEHFLGFLRRLLEYVKWRLRVQHVVQESPPAFLSGLAQRVCIQRKPLRFCAERLRSLLHTLEITDLADFSPLTLLANFATLVSTYAKGQAQHCGSSRNQKRSHP |
Tested applications | ELISA, WB |
Clone Number | 4G2-2A6 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | AAH08346 |
Detection limit for recombinant GST tagged ERCC2 is 3 ng/ml as a capture antibody.
ERCC2 monoclonal antibody (M01J), clone 4G2-2A6. Western Blot analysis of ERCC2 expression in K-562.
Western Blot analysis of ERCC2 expression in transfected 293T cell line by ERCC2 monoclonal antibody (M01J), clone 4G2-2A6. Lane 1: ERCC2 transfected lysate (Predicted MW: 86.9000000 KDa). Lane 2: Non-transfected lysate.
Western Blot detection against Immunogen (70.29 KDa).