ERBB3 monoclonal antibody (M01), clone 2E9

• Catalog Number: orb2293192
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant ERBB3.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG1 kappa
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: ERBB3 (AAH02706, 1 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: MRANDALQVLGLLFSLARGSEVGNSQAVCPGTLNGLSVTGDAENQYQTLYKLYERCEVVMGNLEIVLTGHNADLSFLQWIREVTGYVLVAMNEFSTLPLPNLRVVRGTQVYDGKFAIFVMLNYNTNSSHA
• Tested applications: ELISA, IHC-P, WB
• Clone Number: 2E9
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: AAH02706

Detection limit for recombinant GST tagged ERBB3 is 3 ng/ml as a capture antibody.

ERBB3 monoclonal antibody (M01), clone 2E9 Western Blot analysis of ERBB3 expression in Hela S3 NE.

Immunoperoxidase of monoclonal antibody to ERBB3 on formalin-fixed paraffin-embedded human lung cancer. [antibody concentration 2 ug/ml]

Western Blot detection against Immunogen (40.04 KDa).