You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2293192 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant ERBB3. |
Clonality | Monoclonal |
Species/Host | Mouse |
Isotype | IgG1 kappa |
Conjugation | Unconjugated |
Reactivity | Human |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Immunogen | ERBB3 (AAH02706, 1 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Protein Sequence | MRANDALQVLGLLFSLARGSEVGNSQAVCPGTLNGLSVTGDAENQYQTLYKLYERCEVVMGNLEIVLTGHNADLSFLQWIREVTGYVLVAMNEFSTLPLPNLRVVRGTQVYDGKFAIFVMLNYNTNSSHA |
Tested applications | ELISA, IHC-P, WB |
Clone Number | 2E9 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | AAH02706 |
Detection limit for recombinant GST tagged ERBB3 is 3 ng/ml as a capture antibody.
ERBB3 monoclonal antibody (M01), clone 2E9 Western Blot analysis of ERBB3 expression in Hela S3 NE.
Immunoperoxidase of monoclonal antibody to ERBB3 on formalin-fixed paraffin-embedded human lung cancer. [antibody concentration 2 ug/ml]
Western Blot detection against Immunogen (40.04 KDa).