ERBB3 Rabbit Polyclonal Antibody

SKU: orb573610

Description

Rabbit polyclonal antibody to ERBB3

Research Area

Signal Transduction

Images & Validation

• Tested Applications: IHC
• Reactivity: Human
• Predicted Reactivity: Bovine, Equine, Guinea pig, Mouse, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the following sequence GLLFSLARGSEVGNSQAVCPGTLNGLSVTGDAENQYQTLYKLYERCEVVM
• Target: ERBB3
• Protein Sequence: Synthetic peptide located within the following region: GLLFSLARGSEVGNSQAVCPGTLNGLSVTGDAENQYQTLYKLYERCEVVM
• Molecular Weight: 148 kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

HER3, FERLK, LCCS2, ErbB-3, c-erbB3, erbB3-S, MDA-BF-1, c-erbB-3, p180-ErbB3, p45-sErbB3, p85-sErbB3

Product Page for ERBB3 Antibody (orb573610), Sample Type: Diseased Human Prostate, Primary Antibody dilution: 4 ug/ml, Color/Signal Descriptions: ERBB3 (DAB; brown), nuclei (hematoxylin; blue), Gene Name: ERBB3.

Product Page for ERBB3 Antibody (orb573610), Sample Type: Diseased Human Prostate, Primary Antibody dilution: 4 ug/ml, Color/Signal Descriptions: ERBB3 (DAB; brown), nuclei (hematoxylin; blue), Gene Name: ERBB3.

Quick Database Links

Gene Symbol

ERBB3

UniProt

P21860

RefSeq (Protein):NP_001973