Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

ERBB3 Rabbit Polyclonal Antibody

SKU: orb573610

Description

ERBB3 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of ERBB3. It is suitable for IHC application. The immunogen is a synthetic peptide directed towards the following sequence GLLFSLARGSEVGNSQAVCPGTLNGLSVTGDAENQYQTLYKLYERCEVVM. This antibody reacts with Human samples and is predicted to react with Bovine, Equine, Guinea pig, Mouse, Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Signal Transduction

Images & Validation

Tested ApplicationsIHC
ReactivityHuman
Predicted ReactivityBovine, Equine, Guinea pig, Mouse, Rat

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the following sequence GLLFSLARGSEVGNSQAVCPGTLNGLSVTGDAENQYQTLYKLYERCEVVM
TargetERBB3
Protein SequenceSynthetic peptide located within the following region: GLLFSLARGSEVGNSQAVCPGTLNGLSVTGDAENQYQTLYKLYERCEVVM
Molecular Weight148 kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

HER3, FERLK, LCCS2, ErbB-3, c-erbB3, erbB3-S, MDA-BF-1, c-erbB-3, p180-ErbB3, p45-sErbB3, p85-sErbB3

Similar Products

  • ERBB3 Antibody (N-term) [orb1929060]

    FC,  IHC-P,  WB

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl
  • ErbB-3 (phospho Tyr1222) rabbit pAb Antibody [orb768026]

    ELISA,  IF,  IHC,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    50 μl, 100 μl
  • ErbB-3 (phospho Tyr1289) rabbit pAb Antibody [orb768028]

    ELISA,  IF,  IHC,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    50 μl, 100 μl
  • ErbB-3 rabbit pAb Antibody [orb765165]

    ELISA,  IF,  IHC,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    50 μl, 100 μl
  • PA2G4 Antibody (Center R243) [orb1931398]

    FC,  IF,  IHC-P,  WB

    Mouse, Rat

    Human

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

ERBB3 Rabbit Polyclonal Antibody

Product Page for ERBB3 Antibody (orb573610), Sample Type: Diseased Human Prostate, Primary Antibody dilution: 4 ug/ml, Color/Signal Descriptions: ERBB3 (DAB; brown), nuclei (hematoxylin; blue), Gene Name: ERBB3.

ERBB3 Rabbit Polyclonal Antibody

Product Page for ERBB3 Antibody (orb573610), Sample Type: Diseased Human Prostate, Primary Antibody dilution: 4 ug/ml, Color/Signal Descriptions: ERBB3 (DAB; brown), nuclei (hematoxylin; blue), Gene Name: ERBB3.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_001973

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

IHC
Immunohistochemistry
View Protocol

ERBB3 Rabbit Polyclonal Antibody (orb573610)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry