EPOR monoclonal antibody (M01), clone 3D10

• Catalog Number: orb2293200
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant EPOR.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 3D10
• Tested applications: ELISA, IP, WB
• Reactivity: Human
• Isotype: IgG2b Kappa
• Immunogen: EPOR (NP_000112, 31 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: PDPKFESKAALLAARGPEELLCFTERLEDLVCFWEEAASAGVGPGNYSFSYQLEDEPWKLCRLHQAPTARGAVRFWCSLPTADTSSFVPLELRVTAASGA
• NCBI: NP_000112
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged EPOR is approximately 0.03 ng/ml as a capture antibody.

EPOR monoclonal antibody (M01), clone 3D10. Western Blot analysis of EPOR expression in HeLa.

Immunoprecipitation of EPOR transfected lysate using anti-EPOR monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with EPOR MaxPab rabbit polyclonal antibody.

Western Blot analysis of EPOR expression in transfected 293T cell line by EPOR monoclonal antibody (M01), clone 3D10. Lane 1: EPOR transfected lysate (Predicted MW: 55.1 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (36.74 KDa).