EPHA2 monoclonal antibody (M02), clone 1E3

• Catalog Number: orb2293275
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant EPHA2.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 1E3
• Tested applications: ELISA, IF, WB
• Reactivity: Human
• Isotype: IgG3 Kappa
• Immunogen: EPHA2 (AAH37166, 204 a.a. ~ 326 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: LLQGLAHFPETIAGSDAPSLATVAGTCVDHAVVPPGGEEPRMHCAVDGEWLVPIGQCLCQAGYEKVEDACQACSPGFFKFEASESPCLECPEHTLPSPEGATSCECEEGFFRAPQDPASMPCT
• NCBI: AAH37166
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

EPHA2 monoclonal antibody (M02), clone 1E3 Western Blot analysis of EPHA2 expression in A-431.

EPHA2 monoclonal antibody (M02), clone 1E3. Western Blot analysis of EPHA2 expression in Jurkat.

EPHA2 monoclonal antibody (M02), clone 1E3. Western Blot analysis of EPHA2 expression in U-2 OS.

Immunofluorescence of monoclonal antibody to EPHA2 on A-431 cell. [antibody concentration 10 ug/ml]

Western Blot detection against Immunogen (39.16 KDa).