EPB41 monoclonal antibody (M01), clone 3D9

• Catalog Number: orb2293223
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant EPB41.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 3D9
• Tested applications: ELISA, IF, IHC-P, WB
• Reactivity: Human
• Isotype: IgG1 Kappa
• Immunogen: EPB41 (AAH39079, 116 a.a. ~ 225 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: IEFGTSLDEEIILKAPIAAPEPELKTDPSLDLHSLSSAETQPAQEELREDPDFEIKEGEGLEECSKIEVKEESPQSKAETELKASQKPIRKHRNMHCKVSLLDDTVYECV
• NCBI: AAH39079
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged EPB41 is approximately 0.03 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to EPB41 on HeLa cell. [antibody concentration 10 ug/ml]

Immunoperoxidase of monoclonal antibody to EPB41 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml]

Western Blot analysis of EPB41 expression in transfected 293T cell line by EPB41 monoclonal antibody (M01), clone 3D9. Lane 1: EPB41 transfected lysate (81 KDa). Lane 2: Non-transfected lysate.