Entpd7 Rabbit Polyclonal Antibody

• Catalog Number: orb580755
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Entpd7
• Target: Entpd7
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Entpd7
• Protein Sequence: Synthetic peptide located within the following region: GMAWPVLAQRFKNGLFSSHADEHRLKYQCFKSAWMYEVLHEGFHFPYDYP
• UniProt ID: Q3TCT4
• MW: 69kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: L, Ly, LALP1, Lysal2, 1810012B13Rik, 1810020C02Rik
• Research Area: Epigenetics
• Note: For research use only
• NCBI: NP_444333

Sample Type: Mouse Muscle lysates, Antibody dilution: 1.0 ug/ml.