ENO1 Rabbit Polyclonal Antibody

• Catalog Number: orb575055
• Category: Antibodies
• Description: Rabbit polyclonal antibody to ENO1
• Target: ENO1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human, Rat
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Sheep, Yeast, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Protein A purified
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human ENO1
• Protein Sequence: Synthetic peptide located within the following region: VVGLCTGQIKTGAPCRSERLAKYNQLLRIEEELGSKAKFAGRNFRNPLAK
• UniProt ID: Q53HR3
• MW: 47kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: NNE, PPH, MPB1, ENO1L1, HEL-S-17
• Research Area: Epigenetics & Chromatin, Signal Transduction
• Note: For research use only
• NCBI: NP_001419
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Rat Skeletal Muscle, Antibody dilution: 1 ug/ml.

Rabbit Anti-ENO1 Antibody, Paraffin Embedded Tissue: Human alveolar cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

WB Suggested Anti-ENO1 Antibody Titration: 1.25 ug/ml, ELISA Titer: 1:62500, Positive Control: Jurkat cell lysate, ENO1 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells.