You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2293244 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a full length recombinant EMP3. |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 3D4 |
Tested applications | ELISA, IHC-P, WB |
Reactivity | Human |
Isotype | IgG1 Kappa |
Immunogen | EMP3 (AAH09718, 1 a.a. ~ 163 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Conjugation | Unconjugated |
Protein Sequence | MSLLLLVVSALHILILILLFVATLDKSWWTLPGKESLNLWYDCTWNNDTKTWACSNVSENGWLKAVQVLMVLSLILCCLSFILFMFQLYTMRRGGLFYATGLCQLCTSVAVFTGALIYAIHAEEILEKHPRGGSFGYCFALAWVAFPLALVSGIIYIHLRKRE |
NCBI | AAH09718 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
EMP3 monoclonal antibody (M01), clone 3D4 Western Blot analysis of EMP3 expression in C32.
Immunoperoxidase of monoclonal antibody to EMP3 on formalin-fixed paraffin-embedded human lymphoma tissue. [antibody concentration 3 ug/ml]
Western Blot analysis of EMP3 expression in transfected 293T cell line by EMP3 monoclonal antibody (M01), clone 3D4. Lane 1: EMP3 transfected lysate (18.429 KDa). Lane 2: Non-transfected lysate.
Western Blot detection against Immunogen (43.67 KDa).