EMP3 monoclonal antibody (M01), clone 3D4

• Catalog Number: orb2293244
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a full length recombinant EMP3.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG1 Kappa
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: EMP3 (AAH09718, 1 a.a. ~ 163 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: MSLLLLVVSALHILILILLFVATLDKSWWTLPGKESLNLWYDCTWNNDTKTWACSNVSENGWLKAVQVLMVLSLILCCLSFILFMFQLYTMRRGGLFYATGLCQLCTSVAVFTGALIYAIHAEEILEKHPRGGSFGYCFALAWVAFPLALVSGIIYIHLRKRE
• Tested applications: ELISA, IHC-P, WB
• Clone Number: 3D4
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: AAH09718

EMP3 monoclonal antibody (M01), clone 3D4 Western Blot analysis of EMP3 expression in C32.

Immunoperoxidase of monoclonal antibody to EMP3 on formalin-fixed paraffin-embedded human lymphoma tissue. [antibody concentration 3 ug/ml]

Western Blot analysis of EMP3 expression in transfected 293T cell line by EMP3 monoclonal antibody (M01), clone 3D4. Lane 1: EMP3 transfected lysate (18.429 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (43.67 KDa).