ELMOD2 Rabbit Polyclonal Antibody

SKU: orb582816

Description

Rabbit polyclonal antibody to ELMOD2

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ELMOD2
• Target: ELMOD2
• Protein Sequence: Synthetic peptide located within the following region: FDTYVGAQRTHRIENSLTYSKNKVLQKATHVVQSEVDKYVDDIMKEKNIN
• Molecular Weight: 35kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

9830169G11Rik

WB Suggested Anti-ELMOD2 Antibody Titration: 0.2-1 ug/ml, Positive Control: PANC1 cell lysate.

Quick Database Links

Gene Symbol

ELMOD2

UniProt

Q8IZ81

RefSeq (Protein):NP_714913