ELAVL4 monoclonal antibody (M01), clone 6B9

• Catalog Number: orb2293254
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant ELAVL4.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG1 Kappa
• Conjugation: Unconjugated
• Reactivity: Human, Rat
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: ELAVL4 (NP_068771, 312 a.a. ~ 380 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: VLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASLNGYRLGDRVLQVSFKTNKAHKS
• Tested applications: ELISA, IHC-P, WB
• Clone Number: 6B9
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: NP_068771

Detection limit for recombinant GST tagged ELAVL4 is approximately 1 ng/ml as a capture antibody.

ELAVL4 monoclonal antibody (M01), clone 6B9 Western Blot analysis of ELAVL4 expression in IMR-32.

ELAVL4 monoclonal antibody (M01), clone 6B9. Western Blot analysis of ELAVL4 expression in PC-12.

Immunoperoxidase of monoclonal antibody to ELAVL4 on formalin-fixed paraffin-embedded human cerebral cortex. [antibody concentration 1.2 ug/ml]

Western Blot analysis of ELAVL4 expression in transfected 293T cell line by ELAVL4 monoclonal antibody (M01), clone 6B9. Lane 1: ELAVL4 transfected lysate (40.4 KDa). Lane 2: Non-transfected lysate.

Western blot analysis of ELAVL4 over-expressed 293 cell line, cotransfected with ELAVL4 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with ELAVL4 monoclonal antibody (M01), clone 6B9 (Cat # orb2293254). GAPDH (36.1 kDa) used as specificity and loading control.

Western Blot detection against Immunogen (33.33 KDa).