You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2291682 |
---|---|
Category | Antibodies |
Description | Mouse polyclonal antibody raised against a partial recombinant EIF5B. |
Clonality | Polyclonal |
Species/Host | Mouse |
Conjugation | Unconjugated |
Reactivity | Human |
Buffer/Preservatives | 50 % glycerol |
Immunogen | EIF5B (NP_056988, 1121 a.a. ~ 1218 a.a) partial recombinant protein with GST tag. |
Protein Sequence | QGTPMCVPSKNFVDIGIVTSIEINHKQVDVAKKGQEVCVKIEPIPGESPKMFGRHFEATDILVSKISRQSIDALKDWFRDEMQKSDWQLIVELKKVFE |
Tested applications | ELISA, WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | NP_056988 |
Western Blot detection against Immunogen (36.89 KDa).