EIF4G1 monoclonal antibody (M10), clone 2A9

• Catalog Number: orb2293267
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant EIF4G1.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 2A9
• Tested applications: ELISA, IF, WB
• Reactivity: Human, Mouse, Rat
• Isotype: IgG2b Kappa
• Immunogen: EIF4G1 (NP_886553, 1500 a.a. ~ 1599 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: DVAVLKARAKLLQKYLCDEQKELQALYALQALVVTLEQPPNLLRMFFDALYDEDVVKEDAFYSWESSKDPAEQQGKGVALKSVTAFFKWLREAEEESDHN
• NCBI: NP_886553
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged EIF4G1 is approximately 0.03 ng/ml as a capture antibody.

EIF4G1 monoclonal antibody (M10), clone 2A9 Western Blot analysis of EIF4G1 expression in HepG2.

EIF4G1 monoclonal antibody (M10), clone 2A9. Western Blot analysis of EIF4G1 expression in NIH/3T3.

EIF4G1 monoclonal antibody (M10), clone 2A9. Western Blot analysis of EIF4G1 expression in PC-12.

Immunofluorescence of monoclonal antibody to EIF4G1 on HeLa cell. [antibody concentration 10 ug/ml]

Western Blot analysis of EIF4G1 expression in transfected 293T cell line by EIF4G1 monoclonal antibody (M10), clone 2A9. Lane 1: EIF4G1 transfected lysate (70.95 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (36.74 KDa).