EIF4E2 Rabbit Polyclonal Antibody

• Catalog Number: orb584153
• Category: Antibodies
• Description: Rabbit polyclonal antibody to EIF4E2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human EIF4E2
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 28kDa
• Target: EIF4E2
• UniProt ID: O60573
• Protein Sequence: Synthetic peptide located within the following region: MNNKFDALKDDDSGDHDQNEENSTQKDGEKEKTERDKNQSSSKRKAVVPG
• NCBI: NP_004837
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: 4EHP, IF4e, 4E-LP, h4EHP, EIF4EL3
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml.

Sample Type: Human Jurkat, Antibody dilution: 1.0 ug/ml. There is BioGPS gene expression data showing that EIF4E2 is expressed in Jurkat.

WB Suggested Anti-EIF4E2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: MCF7 cell lysate. EIF4E2 is strongly supported by BioGPS gene expression data to be expressed in Human MCF7 cells.