EIF4B Rabbit Polyclonal Antibody

SKU: orb330120

Description

Rabbit polyclonal antibody to EIF4B

Research Area

Molecular Biology

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Equine, Guinea pig, Mouse, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human EIF4B
• Target: EIF4B
• Protein Sequence: Synthetic peptide located within the following region: NPPARSQSSDTEQQSPTSGGGKVAPAQPSEEGPGRKDENKVDGMNAPKGQ
• Molecular Weight: 67kDa
• Purification: Protein A purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti EIF-4B antibody, anti PRO1843 antibody

Rabbit Anti-EIF4B Antibody, Paraffin Embedded Tissue: Human Heart, Cellular Data: Myocardial cells, Antibody Concentration: 4.0-8.0 ug/mL, Magnification: 400X.

WB Suggested Anti-EIF4B Antibody Titration: 1.25 ug/mL, ELISA Titer: 1:62500, Positive Control: Jurkat cell lysate, EIF4B is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells.

Quick Database Links

Gene Symbol

EIF4B

UniProt

P23588

RefSeq (Protein):NP_001408