EIF2S1 Rabbit Polyclonal Antibody

SKU: orb577629

Description

Rabbit polyclonal antibody to EIF2S1

Research Area

Molecular Biology

Images & Validation

• Tested Applications: WB
• Reactivity: Human, Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Rabbit, Rat, Yeast, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human EIF2S1
• Target: EIF2S1
• Protein Sequence: Synthetic peptide located within the following region: VVVIRVDKEKGYIDLSKRRVSPEEAIKCEDKFTKSKTVYSILRHVAEVLE
• Molecular Weight: 36 kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

EIF2, EIF-2, EIF2A, EIF-2A, EIF-2alpha

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 0.5 ug/ml of the antibody was used in this experiment.

Sample Tissue: Mouse Pancreas, Antibody Dilution: 1 ug/ml.

WB Suggested Anti-EIF2S1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: Human Small Intestine.

Quick Database Links

Gene Symbol

EIF2S1

UniProt

P05198

RefSeq (Protein):NP_004085