You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2292338 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant EIF2AK2. |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 1B9 |
Tested applications | ELISA, IF, IHC-P, WB |
Reactivity | Human |
Isotype | IgG2a Kappa |
Immunogen | EIF2AK2 (NP_002750, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Conjugation | Unconjugated |
Protein Sequence | MAGDLSAGFFMEELNTYRQKQGVVLKYQELPNSGPPHDRRFTFQVIIDGREFPEGEGRSKKEAKNAAAKLAVEILNKEKKAVSPLLLTTTNSSEGLSMGN |
NCBI | NP_002750 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Detection limit for recombinant GST tagged EIF2AK2 is approximately 0.1 ng/ml as a capture antibody.
EIF2AK2 monoclonal antibody (M01), clone 1B9. Western Blot analysis of EIF2AK2 expression in MCF-7.
Immunofluorescence of monoclonal antibody to EIF2AK2 on HeLa cell. [antibody concentration 10 ug/ml]
Immunoperoxidase of monoclonal antibody to EIF2AK2 on formalin-fixed paraffin-embedded human cerebral cortex. [antibody concentration 3 ug/ml]
Western Blot analysis of EIF2AK2 expression in transfected 293T cell line by EIF2AK2 monoclonal antibody (M01), clone 1B9. Lane 1: EIF2AK2 transfected lysate (62.1 KDa). Lane 2: Non-transfected lysate.
Western Blot detection against Immunogen (36.74 KDa).