EGFL7 purified MaxPab rabbit polyclonal antibody (D01P)

• Catalog Number: orb2291160
• Category: Antibodies
• Description: Rabbit polyclonal antibody raised against a full-length human EGFL7 protein.
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: EGFL7 (NP_057299.1, 1 a.a. ~ 273 a.a) full-length human protein.
• Protein Sequence: MRGSQEVLLMWLLVLAVGGTEHAYRPGRRVCAVRAHGDPVSESFVQRVYQPFLTTCDGHRACSTYRTIYRTAYRRSPGLAPARPRYACCPGWKRTSGLPGACGAAICQPPCRNGGSCVQPGRCRCPAGWRGDTCQSDVDECSARRGGCPQRCVNTAGSYWCQCWEGHSLSADGTLCVPKGGPPRVAPNPTGVDSAMKEEVQRLQSRVDLLEEKLQLVLAPLHSLASQALEHGLPDPGSLLVHSFQQLGRIDSLSEQISFLEEQLGSCSCKKDS
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: NP_057299.1

EGFL7 MaxPab rabbit polyclonal antibody. Western Blot analysis of EGFL7 expression in A-431.

EGFL7 MaxPab rabbit polyclonal antibody. Western Blot analysis of EGFL7 expression in human placenta.

Western Blot analysis of EGFL7 expression in transfected 293T cell line by EGFL7 MaxPab polyclonal antibody. Lane 1: EGFL7 transfected lysate(29.60 KDa). Lane 2: Non-transfected lysate.