Efcab14 Rabbit Polyclonal Antibody

SKU: orb325311

Description

Rabbit polyclonal antibody to Efcab14

Images & Validation

• Tested Applications: WB
• Reactivity: Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of 4732418C07Rik
• Target: Efcab14
• Protein Sequence: Synthetic peptide located within the following region: ISALTNKPESNRPPETTDEEQVQNFTSDPSALPEFSQLLRNQIETQVKPL
• Molecular Weight: 59kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti KIAA0494 antibody, anti Kiaa0494 antibody, anti RP23-146I18.2 antibody, anti 4732418C07Rik antibody

WB Suggested Anti-4732418C07Rik Antibody, Titration: 1.0 ug/mL, Positive Control: Mouse Liver.

Quick Database Links

Gene Symbol

Efcab14

UniProt

Q6PCQ6

RefSeq (Protein):NP_766286