Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Page Not Found
Cart summary

You have no items in your shopping cart.

EEA1 Rabbit Polyclonal Antibody

SKU: orb330959

Description

EEA1 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of EEA1. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the N terminal region of human EEA1. This antibody reacts with Human, Mouse, Rat samples and is predicted to react with Bovine, Canine, Equine, Porcine, Rabbit. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cell Biology, Epigenetics & Chromatin, Molecular Biology, Signal Transduction

Images & Validation

Tested ApplicationsWB
ReactivityHuman, Mouse, Rat
Predicted ReactivityBovine, Canine, Equine, Porcine, Rabbit

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human EEA1
TargetEEA1
Protein SequenceSynthetic peptide located within the following region: ESSSEGFICPQCMKSLGSADELFKHYEAVHDAGNDSGHGGESNLALKRDD
Molecular Weight162kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti ZFYVE2 antibody, anti MST105 antibody, anti MSTP105 antibody

Similar Products

  • EEA1 Rabbit Polyclonal Antibody [orb402272]

    ICC,  IF,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • EEA1 Rabbit Polyclonal Antibody [orb1294269]

    IF,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    25 μl, 100 μl
  • Rab5 Antibody (APC) [orb151827]

    ICC,  IF,  IHC,  WB

    Bovine, Human, Monkey, Mouse, Rat

    Rabbit

    Polyclonal

    APC

    100 μg
  • Rab5 Antibody (Biotin) [orb151828]

    ICC,  IF,  IHC,  WB

    Bovine, Human, Monkey, Mouse, Rat

    Rabbit

    Polyclonal

    Biotin

    100 μg
  • Rab5 Antibody (PerCP) [orb151832]

    ICC,  IF,  IHC,  WB

    Bovine, Human, Monkey, Mouse, Rat

    Rabbit

    Polyclonal

    PerCP

    100 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

EEA1 Rabbit Polyclonal Antibody

Sample Tissue: Mouse Testis, Antibody dilution: 1 ug/ml.

EEA1 Rabbit Polyclonal Antibody

WB Suggested Anti-EEA1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: HepG2 cell lysate.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_003557

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

EEA1 Rabbit Polyclonal Antibody (orb330959)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry