EEA1 Rabbit Polyclonal Antibody

SKU: orb330958

Description

Rabbit polyclonal antibody to EEA1

Research Area

Cell Biology, Epigenetics & Chromatin, Molecular Biology

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human EEA1
• Target: EEA1
• Protein Sequence: Synthetic peptide located within the following region: QEKRNQQILKDQVKKEEEELKKEFIEKEAKLHSEIKEKEVGMKKHEENEA
• Molecular Weight: 162kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti ZFYVE2 antibody, anti MST105 antibody, anti MSTP105 antibody

Rabbit Anti-EEA1 Antibody, Catalog Number: orb330958, Formalin Fixed Paraffin Embedded Tissue: Human Adult Liver, Observed Staining: Cytoplasm in hepatocytes, moderate signal, moderate tissue distribution, Primary Antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-EEA1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:12500, Positive Control: 721_B cell lysate, EEA1 is supported by BioGPS gene expression data to be expressed in 721_B.

Quick Database Links

Gene Symbol

EEA1

UniProt

Q15075

RefSeq (Protein):NP_003557