Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

EEA1 Rabbit Polyclonal Antibody

SKU: orb330958

Description

EEA1 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of EEA1. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide directed towards the middle region of human EEA1. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Equine, Rabbit, Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cell Biology, Epigenetics & Chromatin, Molecular Biology

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Rabbit, Rat

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human EEA1
TargetEEA1
Protein SequenceSynthetic peptide located within the following region: QEKRNQQILKDQVKKEEEELKKEFIEKEAKLHSEIKEKEVGMKKHEENEA
Molecular Weight162kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti ZFYVE2 antibody, anti MST105 antibody, anti MSTP105 antibody

Similar Products

  • EEA1 Rabbit Polyclonal Antibody [orb402272]

    ICC,  IF,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • EEA1 Rabbit Polyclonal Antibody [orb1294269]

    IF,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    25 μl, 100 μl
  • Rab5 Antibody (APC) [orb151827]

    ICC,  IF,  IHC,  WB

    Bovine, Human, Monkey, Mouse, Rat

    Rabbit

    Polyclonal

    APC

    100 μg
  • Rab5 Antibody (Biotin) [orb151828]

    ICC,  IF,  IHC,  WB

    Bovine, Human, Monkey, Mouse, Rat

    Rabbit

    Polyclonal

    Biotin

    100 μg
  • Rab5 Antibody (PerCP) [orb151832]

    ICC,  IF,  IHC,  WB

    Bovine, Human, Monkey, Mouse, Rat

    Rabbit

    Polyclonal

    PerCP

    100 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

EEA1 Rabbit Polyclonal Antibody

Rabbit Anti-EEA1 Antibody, Catalog Number: orb330958, Formalin Fixed Paraffin Embedded Tissue: Human Adult Liver, Observed Staining: Cytoplasm in hepatocytes, moderate signal, moderate tissue distribution, Primary Antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

EEA1 Rabbit Polyclonal Antibody

WB Suggested Anti-EEA1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:12500, Positive Control: 721_B cell lysate, EEA1 is supported by BioGPS gene expression data to be expressed in 721_B.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_003557

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

EEA1 Rabbit Polyclonal Antibody (orb330958)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry