You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb589644 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to EDNRB |
Target | EDNRB |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Human |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human EDNRB |
Protein Sequence | Synthetic peptide located within the following region: KRFKNCFKSCLCCWCQSFEEKQSLEEKQSCLKFKANDHGYDNFRSSNKYS |
UniProt ID | P24530 |
MW | 58 kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | ETB, ET-B, ETB1, ETBR, ETRB, HSCR, WS4A, ABCDS, ET Read more... |
Note | For research use only |
NCBI | NP_000106.1 |
Sample Tissue: Human Mesenchymoma Tumor lysates, Antibody Dilution: 1 ug/ml.
FC, IF, IHC-P, WB | |
Equine, Porcine, Rabbit, Rat | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Gallus, Porcine, Rabbit | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Gallus, Mouse, Porcine, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
IH, WB | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |