EDC3 Rabbit Polyclonal Antibody

SKU: orb331300

Description

Rabbit polyclonal antibody to EDC3

Research Area

Molecular Biology

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human EDC3
• Target: EDC3
• Protein Sequence: Synthetic peptide located within the following region: KKSGLKNGQMKNKDDECFGDDIEEIPDTDFDFEGNLALFDKAAVFEEIDT
• Molecular Weight: 56kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti FLJ21128 antibody, anti FLJ31777 antibody, anti LSM16 antibody, anti YJDC antibody, anti YJEFN2 antibody

WB Suggested Anti-EDC3 Antibody, Titration: 1.0 ug/ml, Positive Control: Jurkat Whole Cell, EDC3 is supported by BioGPS gene expression data to be expressed in Jurkat.

Quick Database Links

Gene Symbol

EDC3

UniProt

Q96F86

RefSeq (Protein):NP_079359