You have no items in your shopping cart.
Cart summary
Item 1 of 1
SITPEC Rabbit Polyclonal Antibody
Catalog Number: orb324682
Product Properties
| Catalog Number | orb324682 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to Ecsit |
| Target | Ecsit |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Mouse |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 1.0 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Protein A purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of mouse SITPEC |
| Protein Sequence | Synthetic peptide located within the following region: KVTVYQMSLPSDSTGMEDPTQPHIVGIQSPDQQAALARHNPSRPVFVEGP |
| UniProt ID | Q9QZH6 |
| MW | 48kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | anti Sitpec antibody |
| Research Area | Epigenetics & Chromatin, Immunology & Inflammation Read more... |
| Note | For research use only |
| NCBI | NP_036159 |
Images
WB Suggested Anti-SITPEC Antibody Titration: 1.25 ug/mL, ELISA Titer: 1:1562500, Positive Control: NIH/3T3 cell lysate.
Similar Products
- Item 1 of 1
- Item 1 of 1
ECSIT polyclonal antibody [orb647089]
IF, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
200 μl, 100 μl, 50 μl
Reviews
SITPEC Rabbit Polyclonal Antibody (orb324682)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review