You have no items in your shopping cart.
Cart summary
ECI1 Peptide - C-terminal region
Catalog Number: orb2003421
| Catalog Number | orb2003421 |
|---|---|
| Category | Proteins |
| Description | ECI1 Peptide - C-terminal region |
| Predicted Reactivity | Human |
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized powder |
| Protein Sequence | Synthetic peptide located within the following region: QWMAIPDHARQLTKAMMRKATASRLVTQRDADVQNFVSFISKDSIQKSLQ |
| UniProt ID | P42126 |
| MW | 26kDa |
| Tested applications | WB |
| Application notes | This is a synthetic peptide designed for use in combination with ECI1 Rabbit Polyclonal Antibody (orb580446). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. |
| Storage | Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles. |
| Alternative names | DCI |
| Note | For research use only |
| NCBI | NP_001171500.1 |
