You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1977279 |
---|---|
Category | Proteins |
Description | May contribute to the degradation of peptide hormones and be involved in the inactivation of neuronal peptides. |
Tag | N-10xHis, C-Myc |
Protein Sequence | MEAPYSMTAHYDEFQEVKYVSRCGTGGARGTSLPPGFPRGSGRSASGSRSGLPRWNRREVC |
UniProt ID | Q9JMI0 |
MW | 13.7 kDa (predicted) |
Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
Expression System | E. coli |
Biological Origin | Mouse |
Expression Region | 1-61 aa |
Storage | -20°C |
Note | For research use only |
Expiration Date | 6 months from date of receipt. |