You have no items in your shopping cart.
Cart summary
ECEL1 Protein, Mouse, Recombinant (His & Myc)
Catalog Number: orb1977279
| Catalog Number | orb1977279 |
|---|---|
| Category | Proteins |
| Description | May contribute to the degradation of peptide hormones and be involved in the inactivation of neuronal peptides. |
| Tag | N-10xHis, C-Myc |
| Purity | 98.00% |
| MW | 13.7 kDa (predicted) |
| UniProt ID | Q9JMI0 |
| Protein Sequence | MEAPYSMTAHYDEFQEVKYVSRCGTGGARGTSLPPGFPRGSGRSASGSRSGLPRWNRREVC |
| Expression System | E. coli |
| Biological Origin | Mouse |
| Biological Activity | May contribute to the degradation of peptide hormones and be involved in the inactivation of neuronal peptides. |
| Expression Region | 1-61 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Expiration Date | 6 months from date of receipt. |
