You have no items in your shopping cart.
Cart summary
Item 1 of 1
EBNA1BP2 Rabbit Polyclonal Antibody
Catalog Number: orb586070
| Catalog Number | orb586070 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to EBNA1BP2 |
| Species/Host | Rabbit |
| Clonality | Polyclonal |
| Tested applications | WB |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat |
| Reactivity | Human |
| Concentration | 0.5 mg/ml |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Conjugation | Unconjugated |
| MW | 35kDa |
| Target | EBNA1BP2 |
| UniProt ID | Q99848 |
| Protein Sequence | Synthetic peptide located within the following region: GGKKKGSKWNTRESYDDVSSFRAKTAHGRGLKRPGKKGSNKRPGKRTREK |
| NCBI | NP_006815 |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Alternative names | P40, EBP2, NOBP Read more... |
| Note | For research use only |
| Expiration Date | 12 months from date of receipt. |
WB Suggested Anti-EBNA1BP2 Antibody, Titration: 1.0 ug/ml, Positive Control: HepG2 Whole Cell.
- Item 1 of 2
Anti-EBP2 Antibody [orb412854]
IF, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
200 μl, 100 μl, 50 μl - Item 1 of 1
- Item 1 of 1
- Item 1 of 1
