You have no items in your shopping cart.
Cart summary
Item 1 of 1
E. coli bla protein
Catalog Number: orb246090
| Catalog Number | orb246090 |
|---|---|
| Category | Proteins |
| Description | Recombinant Escherichia coli Beta-lactamase TEM |
| Tag | N-terminal 6xHis-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | HPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW |
| Protein Length | Full Length of Mature Protein |
| UniProt ID | P62593 |
| MW | 30.9 kDa |
| Application notes | This is His-tag protein |
| Endotoxins | Not test. |
| Source | Yeast |
| Biological Origin | Escherichia coli |
| Expression Region | 24-286aa |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Alternative names | bla |
| Note | For research use only |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
- Item 1 of 3
E. coli bla protein [orb244693]
Greater than 90% as determined by SDS-PAGE.
32.2 kDa
E.coli
20 μg, 100 μg, 1 mg - Item 1 of 1
E. coli bla protein [orb244717]
Greater than 90% as determined by SDS-PAGE.
44.9 kDa
E.coli
1 mg, 20 μg, 100 μg - Item 1 of 1
E. coli bla protein [orb246073]
Greater than 90% as determined by SDS-PAGE.
30.2 kDa
Yeast
1 mg, 20 μg, 100 μg - Item 1 of 1
E. coli bla protein [orb605437]
Greater than 85% as determined by SDS-PAGE.
30.2 kDa
Yeast
20 μg, 100 μg, 1 mg 
Bla g 2 Protein, Blattella germanica, Recombinant (His & Myc) [orb1979707]
98.00%
43.4 kDa (predicted)
1 mg, 100 μg, 20 μg
