Cart summary

You have no items in your shopping cart.

DZIP3 Peptide - C-terminal region

DZIP3 Peptide - C-terminal region

Catalog Number: orb1997648

DispatchUsually dispatched within 5-10 working days
$ 230.00
Catalog Numberorb1997648
CategoryProteins
DescriptionDZIP3 Peptide - C-terminal region
Predicted ReactivityHuman
Form/AppearanceLyophilized powder
Buffer/PreservativesLyophilized powder
Protein SequenceSynthetic peptide located within the following region: NLSVLPCAHKFHAQCIRPWLMQQGTCPTCRLHVLLPEEFPGHPSRQLPKI
UniProt IDQ86Y13
MW132 kDa
Application notesThis is a synthetic peptide designed for use in combination with DZIP3 Rabbit Polyclonal Antibody (orb578744). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
StorageAdd 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Alternative namesUURF2, PPP1R66, hRUL138
NoteFor research use only
NCBINP_055463