Dusp7 Rabbit Polyclonal Antibody

• Catalog Number: orb581532
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Dusp7
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Zebrafish
• Reactivity: Rat
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 46 kDa
• Target: Dusp7
• UniProt ID: Q63340
• Protein Sequence: Synthetic peptide located within the following region: GLGGLRISSDCSDGESDRELPSSATESDGSPVPSSQPAFPVQILPYLYLG
• NCBI: XP_238551
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: mkp-X
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Mouse and Rat tissue extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. Recommended dilution for this antibody is 1-3 ug/ml. Recognizes full length protein (45 kDa) and some shorter isoforms in some tissues.

WB Suggested Anti-Dusp7 Antibody, Titration: 1.0 ug/ml, Positive Control: Rat Lung.