RIPK5 Rabbit Polyclonal Antibody

SKU: orb326057

Description

Rabbit polyclonal antibody to DSTYK

Research Area

Neuroscience

Images & Validation

−

Item 1 of 1

Tested Applications	WB
Reactivity	Human
Predicted Reactivity	Bovine, Canine, Guinea pig, Mouse, Rabbit, Rat

Related Conjugates & Formulations

−

Biotin

FITC

HRP

Key Properties

−

Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen is a synthetic peptide directed towards the middle region of human RIPK5
Target	DSTYK
Protein Sequence	Synthetic peptide located within the following region: EECWQLMEACWDGDPLKRPLLGIVQPMLQGIMNRLCKSNSEQPNRGLDDS
Molecular Weight	100kDa
Purification	Affinity Purified
Conjugation	Unconjugated

Storage & Handling

−

Storage	Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/Preservatives	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	0.5 mg/ml
Expiration Date	12 months from date of receipt.
Disclaimer	For research use only

Alternative Names

−

anti DustyPK antibody, anti HDCMD38P antibody, anti KIAA0472 antibody, anti RIP5 antibody, anti RIPK5 antibody

DSTYK Rabbit Polyclonal Antibody [orb101377]

Applications:	ELISA, IF, IHC-Fr, IHC-P, WB
Predicted Reactivity:	Bovine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Sheep
Reactivity:	Human
Species/Host:	Rabbit
Clonality:	Polyclonal
Conjugation:	Unconjugated

Sizes Available: 50 μl, 100 μl, 200 μl

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

WB Suggested Anti-RIPK5 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: Human Spleen.

Quick Database Links

Gene Symbol

DSTYK

UniProt

Q6XUX3

RefSeq (Protein):NP_955749

UniProt Details

−

No UniProt data available

NCBI Reference Sequences

−

Associated Accession Numbers

Curated reference sequences for the gene transcript and protein product

Protein	NP_955749

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Western Blot (IB, immunoblot)

View Protocol

Find More Protocols